PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.E01597.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family NF-YB
Protein Properties Length: 191aa    MW: 21065.6 Da    PI: 8.8307
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.E01597.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB127.74.1e-4063153292
             NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 
                       r+ d++ Pian++ri+++vlP++aki++dake +qecvsefisf+t+ea+ +c+++ r t++++d+l a+a+lGf+dy+e+l+v+l+++r 
  Migut.E01597.1.p  63 RDADEYKPIANITRILRRVLPTHAKIADDAKEAIQECVSEFISFITAEANRRCRHDYRTTVKPEDVLAAMASLGFDDYLESLTVFLNNHRM 153
                       7899***********************************************************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.1E-3856164IPR009072Histone-fold
SuperFamilySSF471137.92E-3170166IPR009072Histone-fold
PfamPF008081.8E-2070132IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006155.1E-1296114No hitNo description
PRINTSPR006155.1E-12115133No hitNo description
PRINTSPR006155.1E-12134152No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MEKGGSSNIK YKYTRRARTS GIVLREGGAA RAAATATNAG NIAGAPLNVG AEEVNQQQQG  60
FKRDADEYKP IANITRILRR VLPTHAKIAD DAKEAIQECV SEFISFITAE ANRRCRHDYR  120
TTVKPEDVLA AMASLGFDDY LESLTVFLNN HRMQQDLERG SRDQLSQFVR RDCGVGVGFL  180
HQQPQGAPNN G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B5e-3263152291Transcription factor HapC (Eurofung)
4g91_B5e-3263152291Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012844767.11e-124PREDICTED: nuclear transcription factor Y subunit B-1-like
SwissprotQ9SFD87e-42NFYB9_ARATH; Nuclear transcription factor Y subunit B-9
TrEMBLA0A022QRD81e-120A0A022QRD8_ERYGU; Uncharacterized protein (Fragment)
STRINGAT1G21970.12e-39(Arabidopsis thaliana)
STRINGscaffold_102467.19e-40(Arabidopsis lyrata)
STRINGscaffold_102469.19e-40(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA6044436
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.11e-42NF-YB family protein